PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00047.105
Common NameAMTR_s00047p00181740, LOC18446169
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family MIKC_MADS
Protein Properties Length: 243aa    MW: 28349.1 Da    PI: 8.9088
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00047.105genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.11.7e-31959151
                                              S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                                    SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                                              krienk+nrqvtfskRr g+lKKA+E+SvLCdaeva+i+fs++gklyeys+
  evm_27.model.AmTr_v1.0_scaffold00047.105  9 KRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTRGKLYEYST 59
                                              79***********************************************96 PP

2K-box103.33e-3478172498
                                     K-box   4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnel 72 
                                               ++ + ++++ +es++ e+akL++++e Lq++qRh++Ge+Le L+l+eLqqLeqqL+ +lk++R +K+++
  evm_27.model.AmTr_v1.0_scaffold00047.105  78 RRATGADHESQESWSLEYAKLRAKVELLQKSQRHYMGEGLEVLNLRELQQLEQQLDVALKHVRGRKTQI 146
                                               55566778889********************************************************** PP

                                     K-box  73 lleqieelqkkekelqeenkaLrkkl 98 
                                               +l++i el++kek+lqe+n +L+kk+
  evm_27.model.AmTr_v1.0_scaffold00047.105 147 MLDSIVELRRKEKSLQEQNDTLQKKI 172
                                               ************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.011161IPR002100Transcription factor, MADS-box
SMARTSM004324.4E-40160IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.75E-34292IPR002100Transcription factor, MADS-box
CDDcd002653.32E-41276No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004048.6E-32323IPR002100Transcription factor, MADS-box
PfamPF003191.3E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004048.6E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004048.6E-323859IPR002100Transcription factor, MADS-box
PfamPF014861.9E-2984172IPR002487Transcription factor, K-box
PROSITE profilePS5129716.89788178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009933Biological Processmeristem structural organization
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MGRGRVQLKR IENKINRQVT FSKRRSGLLK KAHEISVLCD AEVALIVFST RGKLYEYSTD  60
SSMIKILERY ERYSYAERRA TGADHESQES WSLEYAKLRA KVELLQKSQR HYMGEGLEVL  120
NLRELQQLEQ QLDVALKHVR GRKTQIMLDS IVELRRKEKS LQEQNDTLQK KIVAKEKALA  180
QAQATTHWEQ EETAHFLSTS HPHPALNVRF ESREDRDEEE LVEDHHHSLT QPSNVVPPWL  240
FH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A3e-21284182Myocyte-specific enhancer factor 2A
3kov_B3e-21284182Myocyte-specific enhancer factor 2A
3kov_I3e-21284182Myocyte-specific enhancer factor 2A
3kov_J3e-21284182Myocyte-specific enhancer factor 2A
3p57_A3e-21284182Myocyte-specific enhancer factor 2A
3p57_B3e-21284182Myocyte-specific enhancer factor 2A
3p57_C3e-21284182Myocyte-specific enhancer factor 2A
3p57_D3e-21284182Myocyte-specific enhancer factor 2A
3p57_I3e-21284182Myocyte-specific enhancer factor 2A
3p57_J3e-21284182Myocyte-specific enhancer factor 2A
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00096ChIP-seqTransfer from AT1G69120Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006856356.11e-179PREDICTED: truncated transcription factor CAULIFLOWER A
SwissprotQ412763e-89AP1_SINAL; Floral homeotic protein APETALA 1
TrEMBLU5DBN61e-179U5DBN6_AMBTC; Uncharacterized protein
STRINGVIT_01s0011g00100.t014e-98(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69120.15e-68MIKC_MADS family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]